PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000255565
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 103aa    MW: 11481.6 Da    PI: 3.9728
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000255565genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM45.13.2e-143482149
            NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk 49
                   lp G+rF+Pt +e++v+yL +k+ ++ +++ + ikevd+y+++P++Lp+
  MDP0000255565 34 LPLGYRFDPTGDEILVYYLFNKIMDRAMPTYDLIKEVDVYECHPNQLPN 82
                   699********************************************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.41E-143186IPR003441NAC domain
PROSITE profilePS5100515.72534103IPR003441NAC domain
PfamPF023651.3E-43565IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 103 aa     Download sequence    Send to blast
MASSASQSAD ENEGFDLLKC STVQEGXKDA EIRLPLGYRF DPTGDEILVY YLFNKIMDRA  60
MPTYDLIKEV DVYECHPNQL PNASEFGPCL GSNLIALSFC DSQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1981269e-81KF198126.1 Malus hupehensis NAC domain protein (NAC119) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008361771.14e-54PREDICTED: NAC transcription factor 29-like
TrEMBLS5RSJ32e-37S5RSJ3_9R
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15772611
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.15e-13NAC-like, activated by AP3/PI